PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G02297.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 271aa    MW: 31178.4 Da    PI: 7.5812
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G02297.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.18.5e-27959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ien +nrqvtfskRr g++KKA+EL +LCda++ viifs +g++yeyss
  Pahal.G02297.1  9 KKIENPTNRQVTFSKRRMGLFKKANELAILCDAQIGVIIFSGSGRMYEYSS 59
                    68***********************************************96 PP

2K-box57.46.3e-20851621491
           K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                     +++  qe++++k+e + L+    +++GedL s s+++L +Leqq+e sl k+R +K+ell +q+ e++++e  ++ee+
  Pahal.G02297.1  85 QQKIIQEMTRMKDERNRLRIIMGQYMGEDLASFSVEDLSNLEQQMEFSLYKVRLRKQELLDQQLLEMRHREMHMSEEQ 162
                     68899********************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.922161IPR002100Transcription factor, MADS-box
CDDcd002651.04E-38276No hitNo description
SuperFamilySSF554559.68E-30279IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-273859IPR002100Transcription factor, MADS-box
PfamPF014865.5E-1781163IPR002487Transcription factor, K-box
PROSITE profilePS5129712.80685183IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRGKVELKK IENPTNRQVT FSKRRMGLFK KANELAILCD AQIGVIIFSG SGRMYEYSSS  60
PWRIANIFDR YLKAPSTRFE EMDIQQKIIQ EMTRMKDERN RLRIIMGQYM GEDLASFSVE  120
DLSNLEQQME FSLYKVRLRK QELLDQQLLE MRHREMHMSE EQSGYLCLMN PAARGQCQAA  180
EMSGNPRPFP WWDAGASASG SGSQSSQRPH GRDAEPSVTA LQLSPHLHGY RLQPRQPNLQ  240
DANLHGWLCH VLERFEDENQ DGTQPVVALQ T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-17160160Myocyte-specific enhancer factor 2B
1tqe_Q8e-17160160Myocyte-specific enhancer factor 2B
1tqe_R8e-17160160Myocyte-specific enhancer factor 2B
1tqe_S8e-17160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0385320.0BT038532.1 Zea mays full-length cDNA clone ZM_BFb0284C04 mRNA, complete cds.
GenBankBT0691330.0BT069133.1 Zea mays full-length cDNA clone ZM_BFb0202H05 mRNA, complete cds.
GenBankHQ8587370.0HQ858737.1 Zea mays clone UT1435 MADS transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976800.11e-152PREDICTED: MADS-box transcription factor 31-like
SwissprotQ84NC29e-90MAD31_ORYSJ; MADS-box transcription factor 31
TrEMBLA0A096S8I01e-148A0A096S8I0_MAIZE; Uncharacterized protein
STRINGGRMZM2G135018_P011e-148(Zea mays)
STRINGGRMZM2G070151_P021e-146(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.29e-42MIKC_MADS family protein